Ramanandtours / Domestic and International Tours planner .

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Domestic and International Tours planner .
Description	We Ramanand Tours and Travels Provides Domestic as well as International Tours packages with affordable rates. Book now your tour and enjoy our best service.
Keywords	Gujarat Tour Packages, Domestic Tour Packages, International Tour Packages, Holiday Tour Packages, Vacation Tour Packages, Tours and Travel Packages, Surat Travel Agent, Tours and Travel, Special Tour Packages, Honeymoon Tours Packages, Tours and Travel in Surat, Travel Agent in Surat, Group Tours, mumbai tour planner mumbai travel office , mumbai tour packeges, ahmedabad travel company, bharuch travel company, ahmedabad tour and travels company , vadodara tour and travel company , surat tour and travel company, surat travel company , gujarat travel company , shimla manali tour packages , manali tour , shimla tour , travel , toor , tur , taoor , delhi tour , kashmir tour , gulmarg , sonamarg , pahalgam , srinagar , shikara ride , river rafting , paragliding , horse riding , sking , snow fall , snow , snow mountain , villa , hotels , cab , akshardham temple , bloger, instagram , facebook , whatsapp , ram , rama , ramanan , raman , ramanand , ramnan , ramanan , ramanand toor ramanand tours , surat best tour planner , 5 star rating travel company , in surat , in vadodara , in mumbai , in bharuch , in ahmedabad , in amdavad , in gujarat , in rajkot , in gondal , in navsari , travel , hanimun , honeymoon , honeymun , family , family tour , group , group tour , air ticket , ticket , train , yatra , chardham , vaishnodevi , jammu , tulip garden , garden , ganpati , siddhivianayak , dadar , borivali

Server Information

WebSite	www.ramanandtours.com
Host IP	217.21.87.130
Location	United Kingdom

Related Websites

                    Site
                    Rank
                

More to Explore

srikanchimahaswamividyamandir.org

tamilcinemareporter.com

themashhub.com

thudam.cc

burnabyartscouncil.org

bussiness-city.online

Ramanandtours.com Valuation

US$6,807

Last updated: Dec 8, 2022

Ramanandtours.com has global traffic rank of 12,344,146. Ramanandtours.com has an estimated worth of US$ 6,807, based on its estimated Ads revenue. Ramanandtours.com receives approximately 248 unique visitors each day. Its web server is located in United Kingdom, with IP address 217.21.87.130. According to SiteAdvisor, ramanandtours.com is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$6,807
Daily Ads Revenue	US$3
Monthly Ads Revenue	US$111
Yearly Ads Revenue	US$1,361
Daily Unique Visitors	248
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	12,344,146
Delta (90 Days)	0
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
ramanandtours.com	A	1800	IP: 217.21.87.130
ramanandtours.com	AAAA	1800	IPv6: 2a02:4780:11:764:0:2dc9:7c8b:2
ramanandtours.com	MX	14400	Priority: 10 Target: mx2.hostinger.in.
ramanandtours.com	MX	14400	Priority: 5 Target: mx1.hostinger.in.
ramanandtours.com	NS	21600	Target: ns2.dns-parking.com.
ramanandtours.com	NS	21600	Target: ns1.dns-parking.com.
ramanandtours.com	TXT	14400	TXT: v=spf1 include:_spf.mail.hostinger.com ~all
ramanandtours.com	SOA	3600	MNAME: ns1.dns-parking.com. RNAME: dns.hostinger.com. Serial: 2022120801 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 600

HTTP Headers

HTTP/1.1 301 Moved Permanently
Connection: Keep-Alive
Keep-Alive: timeout=5, max=100
content-type: text/html
content-length: 707
date: Thu, 08 Dec 2022 16:18:33 GMT
server: LiteSpeed
location: https://ramanandtours.com/
platform: hostinger
content-security-policy: upgrade-insecure-requests

HTTP/2 200 
x-powered-by: PHP/7.4.32
content-type: text/html; charset=UTF-8
date: Thu, 08 Dec 2022 16:18:34 GMT
server: LiteSpeed
platform: hostinger
content-security-policy: upgrade-insecure-requests
alt-svc: h3=":443"; ma=2592000, h3-29=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q043=":443"; ma=2592000, quic=":443"; ma=2592000; v="43,46"

Ramanandtours.com Whois Information

   Domain Name: RAMANANDTOURS.COM
   Registry Domain ID: 2586571766_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.godaddy.com
   Registrar URL: http://www.godaddy.com
   Updated Date: 2022-10-29T12:48:47Z
   Creation Date: 2021-01-23T09:32:43Z
   Registry Expiry Date: 2024-01-23T09:32:43Z
   Registrar: GoDaddy.com, LLC
   Registrar IANA ID: 146
   Registrar Abuse Contact Email: abuse@godaddy.com
   Registrar Abuse Contact Phone: 480-624-2505
   Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
   Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
   Name Server: NS1.DNS-PARKING.COM
   Name Server: NS2.DNS-PARKING.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: ramanandtours.com
Registry Domain ID: 2586571766_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: https://www.godaddy.com
Updated Date: 2022-01-25T00:47:58Z
Creation Date: 2021-01-23T04:32:43Z
Registrar Registration Expiration Date: 2024-01-23T04:32:43Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: abuse@godaddy.com
Registrar Abuse Contact Phone: +1.4806242505
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 2155 E Warner Rd
Registrant City: Tempe
Registrant State/Province: Arizona
Registrant Postal Code: 85284
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ramanandtours.com
Registry Admin ID: Not Available From Registry
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 2155 E Warner Rd
Admin City: Tempe
Admin State/Province: Arizona
Admin Postal Code: 85284
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ramanandtours.com
Registry Tech ID: Not Available From Registry
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 2155 E Warner Rd
Tech City: Tempe
Tech State/Province: Arizona
Tech Postal Code: 85284
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=ramanandtours.com
Name Server: NS1.DNS-PARKING.COM
Name Server: NS2.DNS-PARKING.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

without notice.

Ramanandtours.com valuation and analysis